Lineage for d3i5vc_ (3i5v C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224399Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2224400Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2224511Family d.151.1.0: automated matches [191468] (1 protein)
    not a true family
  6. 2224512Protein automated matches [190734] (12 species)
    not a true protein
  7. 2224558Species Staphylococcus aureus [TaxId:561307] [225915] (4 PDB entries)
  8. 2224567Domain d3i5vc_: 3i5v C: [211498]
    automated match to d1zwxa1
    complexed with dga

Details for d3i5vc_

PDB Entry: 3i5v (more details), 2.8 Å

PDB Description: Crystal structure of beta toxin 275-280 from Staphylococcus aureus
PDB Compounds: (C:) Beta-hemolysin

SCOPe Domain Sequences for d3i5vc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i5vc_ d.151.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 561307]}
dlklvshnvymlstvlypnwgqykradligqssyiknndvvifneafdngasdkllsnvk
keypyqtpvlgrsqsgwdktegsysstvaedggvaivskypikekiqhvfksgcgfdnds
nkgfvytkiekngknvhvigthtqsedsrcgaghdrkiraeqmkeisdfvkkknipkdet
vyiggdlnvnkgtpefkdmlknlnvndvlyaghnstwdpqsnsiakynypngkpehldyi
ftdkdhkqpkqlvnevvtekpkpwdvdgyvyndfsdhypikays

SCOPe Domain Coordinates for d3i5vc_:

Click to download the PDB-style file with coordinates for d3i5vc_.
(The format of our PDB-style files is described here.)

Timeline for d3i5vc_: