Lineage for d3i4ec_ (3i4e C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2837913Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2838112Family c.1.12.7: Phosphoenolpyruvate mutase/Isocitrate lyase-like [88704] (4 proteins)
    forms a swapped dimer
  6. 2838206Protein automated matches [190974] (9 species)
    not a true protein
  7. 2838212Species Burkholderia pseudomallei [TaxId:28450] [225729] (1 PDB entry)
  8. 2838215Domain d3i4ec_: 3i4e C: [211472]
    automated match to d3lg3b_

Details for d3i4ec_

PDB Entry: 3i4e (more details), 2.69 Å

PDB Description: Crystal structure of Isocitrate Lyase from Burkholderia pseudomallei
PDB Compounds: (C:) isocitrate lyase

SCOPe Domain Sequences for d3i4ec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i4ec_ c.1.12.7 (C:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
msrqqqaqelqkqwetdprwkgikraftaedvvrlrgsiqqehtlakrgaeklwtlinne
pfvnalgaltgnqamqqvkaglkaiylsgwqvagdanvagemypdqslypansvplvvkr
inntltradqiqwsegknpgdegyvdffapivadaeagfggvlnafelmkamieagasgv
hfedqlasvkkcghmggkvlvptreavakltaarlaadvmgtptvlvartdaeaadlits
diddndkpyltgertvegffrtkpgleqaisrglayapyadliwcetgkpdleyakkfae
aihkqfpgkllsyncspsfnwkknlddatiakfqkelgamgykfqfitlagfhalnysmf
nlahgyartqmsafvelqqaefaaadkgftavkhqrevgtgyfdavtqtver

SCOPe Domain Coordinates for d3i4ec_:

Click to download the PDB-style file with coordinates for d3i4ec_.
(The format of our PDB-style files is described here.)

Timeline for d3i4ec_: