SCOPe 2.06: Domain d3i46a_: 3i46 A:

Lineage for d3i46a_ (3i46 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.0: automated matches [191468] (1 protein)
   not a true family

6. Protein automated matches [190734] (12 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:561307] [225915] (4 PDB entries)

8. Domain d3i46a_: 3i46 A: [211462]
   automated match to d1zwxa1
   complexed with ca, cl; mutant

Details for d3i46a_

PDB Entry: 3i46, 2.6 Å

PDB Description: crystal structure of beta toxin from staphylococcus aureus f277a, p278a mutant with bound calcium ions

PDB Compounds: (A:) Beta-hemolysin

SCOPe Domain Sequences for d3i46a_:

Sequence; same for both SEQRES and ATOM records:

>d3i46a_ d.151.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 561307]}
dlklvshnvymlstvlypnwgqykradligqssyiknndvvifneafdngasdkllsnvk
keypyqtpvlgrsqsgwdktegsysstvaedggvaivskypikekiqhvfksgcgfdnds
nkgfvytkiekngknvhvigthtqsedsrcgaghdrkiraeqmkeisdfvkkknipkdet
vyiggdlnvnkgtpefkdmlknlnvndvlyaghnstwdpqsnsiakynypngkpehldyi
ftdkdhkqpkqlvnevvtekpkpwdvyaaayyyvyndfsdhypikaysk

Timeline for d3i46a_:

• d3i46a_ first appeared in SCOPe 2.03
  
• d3i46a_ appears in SCOPe 2.05
  
• d3i46a_ appears in SCOPe 2.07
  
• d3i46a_ appears in the current release, SCOPe 2.08