Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) |
Family c.33.1.0: automated matches [191389] (1 protein) not a true family |
Protein automated matches [190499] (25 species) not a true protein |
Species Desulfovibrio vulgaris [TaxId:882] [225697] (1 PDB entry) |
Domain d3hu5a_: 3hu5 A: [211304] automated match to d3kl2e_ |
PDB Entry: 3hu5 (more details), 1.5 Å
SCOPe Domain Sequences for d3hu5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hu5a_ c.33.1.0 (A:) automated matches {Desulfovibrio vulgaris [TaxId: 882]} nrtvalaiidmqndfvlpgapacvegamgtvpviagllakaraegwmvlhvvrahradgs daeksrehlfleggglcvagtpgaeivaglepasgetvlvktrfsafmgtecdmllrrrg vdtllvsgtqypncirgtavdafaldydvvvvtdacsartpgvaesnindmramgitcvp ltalddvlar
Timeline for d3hu5a_: