Lineage for d3hq0a2 (3hq0 A:147-298)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2549433Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2549434Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2549945Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2549946Protein automated matches [190239] (26 species)
    not a true protein
  7. 2550056Species Pseudomonas sp. [TaxId:237609] [225772] (3 PDB entries)
  8. 2550066Domain d3hq0a2: 3hq0 A:147-298 [211203]
    automated match to d1mpya2
    complexed with fe, m3p

Details for d3hq0a2

PDB Entry: 3hq0 (more details), 2 Å

PDB Description: crystal structure analysis of the 2,3-dioxygenase lapb from pseudomonas in complex with a product
PDB Compounds: (A:) catechol 2,3-dioxygenase

SCOPe Domain Sequences for d3hq0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hq0a2 d.32.1.0 (A:147-298) automated matches {Pseudomonas sp. [TaxId: 237609]}
iapiqldhcllygpniaevqkiftevlgfylvervlspdgdsdmgiwlscshkvhdiafv
eypekgklhhcsfllesweqvlragdimsmnevnvdigptrhgvtrgctiyawdpsgnrf
etfmggyhpypdyeplswtydnfaqgldypqr

SCOPe Domain Coordinates for d3hq0a2:

Click to download the PDB-style file with coordinates for d3hq0a2.
(The format of our PDB-style files is described here.)

Timeline for d3hq0a2: