SCOP 1.69: Domain d2rcsh2: 2rcs H:115-216

Lineage for d2rcsh2 (2rcs H:115-216)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (82 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d2rcsh2: 2rcs H:115-216 [21119]
   Other proteins in same PDB: d2rcsh1, d2rcsl1, d2rcsl2
   part of humanized Fab 48G7

Details for d2rcsh2

PDB Entry: 2rcs, 2.1 Å

PDB Description: immunoglobulin 48g7 germline fab-affinity maturation of an esterolytic antibody

SCOP Domain Sequences for d2rcsh2:

Sequence; same for both SEQRES and ATOM records:

>d2rcsh2 b.1.1.2 (H:115-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

Timeline for d2rcsh2:

• d2rcsh2 first appeared (with stable ids) in SCOP 1.55
  
• d2rcsh2 appears in SCOP 1.67
  
• d2rcsh2 appears in SCOP 1.71
  
• d2rcsh2 appears in the current release, SCOPe 2.08