SCOPe 2.08: Domain d3hn6c1: 3hn6 C:1-268

Lineage for d3hn6c1 (3hn6 C:1-268)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families)

5. Family c.124.1.0: automated matches [191609] (1 protein)
   not a true family

6. Protein automated matches [191112] (17 species)
   not a true protein

7. Species Borrelia burgdorferi [TaxId:224326] [225689] (1 PDB entry)

8. Domain d3hn6c1: 3hn6 C:1-268 [211148]
   Other proteins in same PDB: d3hn6a2, d3hn6b2, d3hn6c2, d3hn6d2, d3hn6e2, d3hn6f2
   automated match to d1fsfa_
   complexed with pop

Details for d3hn6c1

PDB Entry: 3hn6, 2.2 Å

PDB Description: crystal structure of glucosamine-6-phosphate deaminase from borrelia burgdorferi

PDB Compounds: (C:) glucosamine-6-phosphate deaminase

SCOPe Domain Sequences for d3hn6c1:

Sequence; same for both SEQRES and ATOM records:

>d3hn6c1 c.124.1.0 (C:1-268) automated matches {Borrelia burgdorferi [TaxId: 224326]}
mrliirptyediskwaanhvaqkinefsptkenpfilglptgsspigmyknlielnknkk
isfqnvitfnmdeyigieenhpesyhsfmwnnffshidikkeninilngnasnlkkecee
yekkiksfggimlfvggigpdghiafnepgssltsrtriktltqdtiiansrffegdvnk
vpknaltvgigtimdsqevliivnghnkaralkhaiekgvnhmwtisalqlhknaiivsd
knatyelkvgtveyfndierknfnndlk

Timeline for d3hn6c1:

• d3hn6c1 first appeared in SCOPe 2.03, called d3hn6c_
  
• d3hn6c1 appears in SCOPe 2.07