SCOPe 2.05: Domain d3hm8d1: 3hm8 D:479-676

Lineage for d3hm8d1 (3hm8 D:479-676)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (49 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224896] (42 PDB entries)

8. Domain d3hm8d1: 3hm8 D:479-676 [211127]
   automated match to d1bdga1
   complexed with bg6, glc

Details for d3hm8d1

PDB Entry: 3hm8, 2.8 Å

PDB Description: crystal structure of the c-terminal hexokinase domain of human hk3

PDB Compounds: (D:) Hexokinase-3

SCOPe Domain Sequences for d3hm8d1:

Sequence; same for both SEQRES and ATOM records:

>d3hm8d1 c.55.1.0 (D:479-676) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srrlleetlapfrlnhdqlaavqaqmrkamakglrgeasslrmlptfvratpdgsergdf
laldlggtnfrvllvrvttgvqitseiysipetvaqgsgqqlfdhivdcivdfqqkqgls
gqslplgftfsfpcrqlgldqgillnwtkgfkasdcegqdvvsllreaitrrqavelnvv
aivndtvgtmmscgyedp

Timeline for d3hm8d1:

• d3hm8d1 first appeared in SCOPe 2.03
  
• d3hm8d1 appears in SCOPe 2.04
  
• d3hm8d1 appears in SCOPe 2.06
  
• d3hm8d1 appears in the current release, SCOPe 2.08