Lineage for d3hm8a1 (3hm8 A:479-676)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858517Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1858518Protein automated matches [226839] (49 species)
    not a true protein
  7. 1858644Species Human (Homo sapiens) [TaxId:9606] [224896] (42 PDB entries)
  8. 1858752Domain d3hm8a1: 3hm8 A:479-676 [211121]
    automated match to d1bdga1
    complexed with bg6, glc

Details for d3hm8a1

PDB Entry: 3hm8 (more details), 2.8 Å

PDB Description: crystal structure of the c-terminal hexokinase domain of human hk3
PDB Compounds: (A:) Hexokinase-3

SCOPe Domain Sequences for d3hm8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hm8a1 c.55.1.0 (A:479-676) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srrlleetlapfrlnhdqlaavqaqmrkamakglrgeasslrmlptfvratpdgsergdf
laldlggtnfrvllvrvttgvqitseiysipetvaqgsgqqlfdhivdcivdfqqkqgls
gqslplgftfsfpcrqlgldqgillnwtkgfkasdcegqdvvsllreaitrrqavelnvv
aivndtvgtmmscgyedp

SCOPe Domain Coordinates for d3hm8a1:

Click to download the PDB-style file with coordinates for d3hm8a1.
(The format of our PDB-style files is described here.)

Timeline for d3hm8a1: