Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) many known members contain KOW motif |
Family b.34.5.0: automated matches [227245] (1 protein) not a true family |
Protein automated matches [227015] (5 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225759] (1 PDB entry) |
Domain d3hksa1: 3hks A:16-84 [211115] Other proteins in same PDB: d3hksa2, d3hksb2 automated match to d1xtda1 complexed with edo |
PDB Entry: 3hks (more details), 2.3 Å
SCOPe Domain Sequences for d3hksa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hksa1 b.34.5.0 (A:16-84) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} sktypqsagnirkgghiviknrpckvvevstsktgkhghakchfvaidiftakkledivp sshncdvph
Timeline for d3hksa1: