PDB entry 3hks

View 3hks on RCSB PDB site
Description: Crystal structure of eukaryotic translation initiation factor eIF-5A2 from Arabidopsis thaliana
Class: translation, RNA binding protein
Keywords: BETA BARREL, Alternative splicing, Hypusine, Initiation factor, Protein biosynthesis, TRANSLATION, RNA BINDING PROTEIN
Deposited on 2009-05-25, released 2009-09-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-09-29, with a file datestamp of 2009-09-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.204
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Eukaryotic translation initiation factor 5A-2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At1G26630.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3hksa1, d3hksa2
  • Chain 'B':
    Compound: Eukaryotic translation initiation factor 5A-2
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At1G26630.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3hksb1, d3hksb2
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hksA (A:)
    mghhhhhhmsddehhfeasesgasktypqsagnirkgghiviknrpckvvevstsktgkh
    ghakchfvaidiftakkledivpsshncdvphvnrvdyqliditedgfvslltdsggtkd
    dlklptddgltaqmrlgfdegkdivvsvmssmgeeqicavkevgggk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hksA (A:)
    sktypqsagnirkgghiviknrpckvvevstsktgkhghakchfvaidiftakkledivp
    sshncdvphvnrvdyqliditedgfvslltdsggtkddlklptddgltaqmrlgfdegkd
    ivvsvmssmgeeqicavkevgggk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hksB (B:)
    mghhhhhhmsddehhfeasesgasktypqsagnirkgghiviknrpckvvevstsktgkh
    ghakchfvaidiftakkledivpsshncdvphvnrvdyqliditedgfvslltdsggtkd
    dlklptddgltaqmrlgfdegkdivvsvmssmgeeqicavkevgggk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hksB (B:)
    sktypqsagnirkgghiviknrpckvvevstsktgkhghakchfvaidiftakkledivp
    sshncdvphvnrvdyqliditedgfvslltdsggtkddlklptddgltaqmrlgfdegkd
    ivvsvmssmgeeqicavkevgg