Lineage for d3ha3a_ (3ha3 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893430Family c.66.1.18: Mycolic acid cyclopropane synthase [69560] (7 proteins)
  6. 2893449Protein Methoxy mycolic acid synthase 4, Mma4 [142591] (1 species)
  7. 2893450Species Mycobacterium tuberculosis [TaxId:1773] [142592] (5 PDB entries)
    Uniprot Q79FX8 22-301
  8. 2893453Domain d3ha3a_: 3ha3 A: [210946]
    automated match to d2fk7a1
    complexed with sah

Details for d3ha3a_

PDB Entry: 3ha3 (more details), 2.2 Å

PDB Description: Crystal structure of HMA (MMAA4) from mycobacterium tuberculosis complexed with S-adenosylhomocysteine
PDB Compounds: (A:) methoxy mycolic acid synthase 4

SCOPe Domain Sequences for d3ha3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ha3a_ c.66.1.18 (A:) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]}
iqahydvsddffalfqdptrtyscayfeppeltleeaqyakvdlnldkldlkpgmtlldi
gcgwgttmrraverfdvnvigltlsknqharceqvlasidtnrsrqvllqgwedfaepvd
rivsieafehfghenyddffkrcfnimpadgrmtvqssvsyhpyemaargkklsfetarf
ikfivteifpggrlpstemmvehgekagftvpeplslrphyiktlriwgdtlqsnkdkai
evtseevynrymkylrgcehyftdemldcslvtylkpgaaa

SCOPe Domain Coordinates for d3ha3a_:

Click to download the PDB-style file with coordinates for d3ha3a_.
(The format of our PDB-style files is described here.)

Timeline for d3ha3a_: