Lineage for d3h7ua_ (3h7u A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829136Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2829673Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2829674Protein automated matches [190793] (31 species)
    not a true protein
  7. 2829808Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225720] (2 PDB entries)
  8. 2829809Domain d3h7ua_: 3h7u A: [210898]
    automated match to d3ln3a_
    complexed with act, nap

Details for d3h7ua_

PDB Entry: 3h7u (more details), 1.25 Å

PDB Description: Crystal structure of the plant stress-response enzyme AKR4C9
PDB Compounds: (A:) aldo-keto reductase

SCOPe Domain Sequences for d3h7ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h7ua_ c.1.7.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
aitffklntgakfpsvglgtwqaspglvgdavaaavkigyrhidcaqiygnekeigavlk
klfedrvvkredlfitsklwctdhdpqdvpealnrtlkdlqleyvdlylihwparikkgs
vgikpenllpvdipstwkamealydsgkaraigvsnfstkkladllelarvppavnqvec
hpswrqtklqefckskgvhlsaysplgspgttwlksdvlknpilnmvaeklgkspaqval
rwglqmghsvlpkstnegrikenfnvfdwsipdymfakfaeieqarlvtgsflvhetlsp
yksieelwdgei

SCOPe Domain Coordinates for d3h7ua_:

Click to download the PDB-style file with coordinates for d3h7ua_.
(The format of our PDB-style files is described here.)

Timeline for d3h7ua_: