SCOPe 2.03: Domain d3h7ua_: 3h7u A:

Lineage for d3h7ua_ (3h7u A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.0: automated matches [191491] (1 protein)
   not a true family

6. Protein automated matches [190793] (18 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225720] (2 PDB entries)

8. Domain d3h7ua_: 3h7u A: [210898]
   automated match to d3ln3a_
   complexed with act, nap

Details for d3h7ua_

PDB Entry: 3h7u, 1.25 Å

PDB Description: Crystal structure of the plant stress-response enzyme AKR4C9

PDB Compounds: (A:) aldo-keto reductase

SCOPe Domain Sequences for d3h7ua_:

Sequence; same for both SEQRES and ATOM records:

>d3h7ua_ c.1.7.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
aitffklntgakfpsvglgtwqaspglvgdavaaavkigyrhidcaqiygnekeigavlk
klfedrvvkredlfitsklwctdhdpqdvpealnrtlkdlqleyvdlylihwparikkgs
vgikpenllpvdipstwkamealydsgkaraigvsnfstkkladllelarvppavnqvec
hpswrqtklqefckskgvhlsaysplgspgttwlksdvlknpilnmvaeklgkspaqval
rwglqmghsvlpkstnegrikenfnvfdwsipdymfakfaeieqarlvtgsflvhetlsp
yksieelwdgei

Timeline for d3h7ua_:

• d3h7ua_ is new in SCOPe 2.03-stable
  
• d3h7ua_ appears in SCOPe 2.04
  
• d3h7ua_ appears in the current release, SCOPe 2.08