Lineage for d3h7ab_ (3h7a B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1581437Species Rhodopseudomonas palustris [TaxId:1076] [225667] (1 PDB entry)
  8. 1581439Domain d3h7ab_: 3h7a B: [210894]
    automated match to d1xg5a_
    complexed with unl

Details for d3h7ab_

PDB Entry: 3h7a (more details), 1.87 Å

PDB Description: crystal structure of short-chain dehydrogenase from rhodopseudomonas palustris
PDB Compounds: (B:) Short chain dehydrogenase

SCOPe Domain Sequences for d3h7ab_:

Sequence, based on SEQRES records: (download)

>d3h7ab_ c.2.1.0 (B:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
tprnatvavigagdyigaeiakkfaaegftvfagrrngeklaplvaeieaaggrivarsl
darnedevtaflnaadahaplevtifnvganvnfpilettdrvfrkvwemacwagfvsgr
esarlmlahgqgkifftgataslrggsgfaafasakfglravaqsmarelmpknihvahl
iidsgvdtawvrerreqmfgkdalanpdllmppaavagaywqlyqqpksawtfemeirpy

Sequence, based on observed residues (ATOM records): (download)

>d3h7ab_ c.2.1.0 (B:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
tprnatvavigagdyigaeiakkfaaegftvfagrrngeklaplvaeieaaggrivarsl
darnedevtaflnaadahaplevtifnvganvnfpilettdrvfrkvwemacwagfvsgr
esarlmlahgqgkifftgataslrggsgfaafasakfglravaqsmarelmpknihvahl
iidmppaavagaywqlyqqpksawtfemeirpy

SCOPe Domain Coordinates for d3h7ab_:

Click to download the PDB-style file with coordinates for d3h7ab_.
(The format of our PDB-style files is described here.)

Timeline for d3h7ab_: