Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (181 species) not a true protein |
Species Rhodopseudomonas palustris [TaxId:1076] [225667] (1 PDB entry) |
Domain d3h7ab_: 3h7a B: [210894] automated match to d1xg5a_ complexed with unl |
PDB Entry: 3h7a (more details), 1.87 Å
SCOPe Domain Sequences for d3h7ab_:
Sequence, based on SEQRES records: (download)
>d3h7ab_ c.2.1.0 (B:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]} tprnatvavigagdyigaeiakkfaaegftvfagrrngeklaplvaeieaaggrivarsl darnedevtaflnaadahaplevtifnvganvnfpilettdrvfrkvwemacwagfvsgr esarlmlahgqgkifftgataslrggsgfaafasakfglravaqsmarelmpknihvahl iidsgvdtawvrerreqmfgkdalanpdllmppaavagaywqlyqqpksawtfemeirpy
>d3h7ab_ c.2.1.0 (B:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]} tprnatvavigagdyigaeiakkfaaegftvfagrrngeklaplvaeieaaggrivarsl darnedevtaflnaadahaplevtifnvganvnfpilettdrvfrkvwemacwagfvsgr esarlmlahgqgkifftgataslrggsgfaafasakfglravaqsmarelmpknihvahl iidmppaavagaywqlyqqpksawtfemeirpy
Timeline for d3h7ab_: