Lineage for d3h45o2 (3h45 O:255-501)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605693Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 1605694Protein Glycerol kinase [53090] (2 species)
  7. 1605695Species Enterococcus casseliflavus [TaxId:37734] [117641] (8 PDB entries)
    Uniprot O34153 5-491
  8. 1605725Domain d3h45o2: 3h45 O:255-501 [210857]
    automated match to d3ezwd2
    complexed with edo, po4

Details for d3h45o2

PDB Entry: 3h45 (more details), 2.65 Å

PDB Description: glycerol kinase h232e with ethylene glycol
PDB Compounds: (O:) glycerol kinase

SCOPe Domain Sequences for d3h45o2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h45o2 c.55.1.4 (O:255-501) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]}
mafekgmikntygtgafivmntgeepqlsdndllttigygingkvyyalegsifvagsai
qwlrdglrmietspqseelaakakgdnevyvvpaftglgapywdseargavfgltrgttk
edfvratlqavayqskdvidtmkkdsgidipllkvdggaakndllmqfqadildidvqra
anlettalgaaylaglavgfwkdldelksmaeegqmftpempaeerdnlyegwkqavaat
qtfkfka

SCOPe Domain Coordinates for d3h45o2:

Click to download the PDB-style file with coordinates for d3h45o2.
(The format of our PDB-style files is described here.)

Timeline for d3h45o2: