Lineage for d3h3bd1 (3h3b D:1-113)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759965Domain d3h3bd1: 3h3b D:1-113 [210812]
    Other proteins in same PDB: d3h3ba1, d3h3ba2, d3h3ba3, d3h3bb1, d3h3bb2, d3h3bb3, d3h3bc3, d3h3bd3
    automated match to d1nqba2

Details for d3h3bd1

PDB Entry: 3h3b (more details), 2.45 Å

PDB Description: Crystal structure of the single-chain Fv (scFv) fragment of an anti-ErbB2 antibody chA21 in complex with residues 1-192 of ErbB2 extracellular domain
PDB Compounds: (D:) anti-ErbB2 antibody chA21

SCOPe Domain Sequences for d3h3bd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h3bd1 b.1.1.0 (D:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqtpsslpvsvgekvtmtckssqtllysnnqknylawyqqkpgqspklliswaftr
ksgvpdrftgsgsgtdftltigsvkaedlavyycqqysnypwtfgggtrleik

SCOPe Domain Coordinates for d3h3bd1:

Click to download the PDB-style file with coordinates for d3h3bd1.
(The format of our PDB-style files is described here.)

Timeline for d3h3bd1: