PDB entry 3h3b

View 3h3b on RCSB PDB site
Description: Crystal structure of the single-chain Fv (scFv) fragment of an anti-ErbB2 antibody chA21 in complex with residues 1-192 of ErbB2 extracellular domain
Class: immune system
Keywords: immunoglobulin, beta-helix, protein-protein complex, ATP-binding, Disulfide bond, Kinase, Nucleotide-binding, Receptor, Transferase, Transmembrane, Tyrosine-protein kinase, Immune System
Deposited on 2009-04-16, released 2010-04-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.203
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor tyrosine-protein kinase erbB-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ERBB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04626 (2-193)
      • expression tag (1)
    Domains in SCOPe 2.07: d3h3ba1, d3h3ba2, d3h3ba3
  • Chain 'B':
    Compound: Receptor tyrosine-protein kinase erbB-2
    Species: Homo sapiens [TaxId:9606]
    Gene: ERBB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04626 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d3h3bb1, d3h3bb2, d3h3bb3
  • Chain 'C':
    Compound: anti-ErbB2 antibody chA21
    Species: Mus musculus [TaxId:10090]
    Gene: scFv of murine antibody A21
    Database cross-references and differences (RAF-indexed):
    • PDB 3H3B
    Domains in SCOPe 2.07: d3h3bc1, d3h3bc2
  • Chain 'D':
    Compound: anti-ErbB2 antibody chA21
    Species: Mus musculus [TaxId:10090]
    Gene: scFv of murine antibody A21
    Database cross-references and differences (RAF-indexed):
    • PDB 3H3B
    Domains in SCOPe 2.07: d3h3bd1, d3h3bd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3h3bA (A:)
    gstqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltylptnaslsflqdiqev
    qgyvliahnqvrqvplqrlrivrgtqlfednyalavldngdplnnttpvtgaspgglrel
    qlrslteilkggvliqrnpqlcyqdtilwkdifhknnqlaltlidtnrsrachpcspmck
    gsrcwgessedcqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h3bA (A:)
    stqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltylptnaslsflqdiqevq
    gyvliahnqvrqvplqrlrivrgtqlfednyalavldngdplnnttpvtgaspgglrelq
    lrslteilkggvliqrnpqlcyqdtilwkdifhknnqlaltlidtnrsrachpcspmckg
    srcwgessedcqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3h3bB (B:)
    gstqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltylptnaslsflqdiqev
    qgyvliahnqvrqvplqrlrivrgtqlfednyalavldngdplnnttpvtgaspgglrel
    qlrslteilkggvliqrnpqlcyqdtilwkdifhknnqlaltlidtnrsrachpcspmck
    gsrcwgessedcqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h3bB (B:)
    stqvctgtdmklrlpaspethldmlrhlyqgcqvvqgnleltylptnaslsflqdiqevq
    gyvliahnqvrqvplqrlrivrgtqlfednyalavldngdplnnttpvtgaspgglrelq
    lrslteilkggvliqrnpqlcyqdtilwkdifhknnqlaltlidtnrsrachpcspmcrc
    wgessedcq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3h3bC (C:)
    aaqpadivltqtpsslpvsvgekvtmtckssqtllysnnqknylawyqqkpgqspkllis
    waftrksgvpdrftgsgsgtdftltigsvkaedlavyycqqysnypwtfgggtrleikrg
    gggsggggsggggsggggsevqlqqsgpevvktgasvkisckasgysftgyfinwvkkns
    gkspewighisssyatstynqkfknkaaftvdtssstafmqlnsltsedsavyycvrsgn
    yeeyamdywgqgtsvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h3bC (C:)
    qpadivltqtpsslpvsvgekvtmtckssqtllysnnqknylawyqqkpgqspklliswa
    ftrksgvpdrftgsgsgtdftltigsvkaedlavyycqqysnypwtfgggtrleievqlq
    qsgpevvktgasvkisckasgysftgyfinwvkknsgkspewighisssyatstynqkfk
    nkaaftvdtssstafmqlnsltsedsavyycvrsgnyeeyamdywgqgtsvtvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3h3bD (D:)
    aaqpadivltqtpsslpvsvgekvtmtckssqtllysnnqknylawyqqkpgqspkllis
    waftrksgvpdrftgsgsgtdftltigsvkaedlavyycqqysnypwtfgggtrleikrg
    gggsggggsggggsggggsevqlqqsgpevvktgasvkisckasgysftgyfinwvkkns
    gkspewighisssyatstynqkfknkaaftvdtssstafmqlnsltsedsavyycvrsgn
    yeeyamdywgqgtsvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >3h3bD (D:)
    qpadivltqtpsslpvsvgekvtmtckssqtllysnnqknylawyqqkpgqspklliswa
    ftrksgvpdrftgsgsgtdftltigsvkaedlavyycqqysnypwtfgggtrleiksevq
    lqqsgpevvktgasvkisckasgysftgyfinwvkknsgkspewighisssyatstynqk
    fknkaaftvdtssstafmqlnsltsedsavyycvrsgnyeeyamdywgqgtsvtvs