SCOPe 2.04: Domain d3h1vx1: 3h1v X:15-218

Lineage for d3h1vx1 (3h1v X:15-218)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.3: Hexokinase [53083] (3 proteins)

6. Protein Glucokinase [102479] (1 species)
   Hexokinase D

7. Species Human (Homo sapiens) [TaxId:9606] [102480] (6 PDB entries)

8. Domain d3h1vx1: 3h1v X:15-218 [210784]
   automated match to d1v4ta1
   complexed with glc, na, tk1

Details for d3h1vx1

PDB Entry: 3h1v, 2.11 Å

PDB Description: human glucokinase in complex with a synthetic activator

PDB Compounds: (X:) Glucokinase

SCOPe Domain Sequences for d3h1vx1:

Sequence; same for both SEQRES and ATOM records:

>d3h1vx1 c.55.1.3 (X:15-218) Glucokinase {Human (Homo sapiens) [TaxId: 9606]}
mveqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlptyvrstpegsevgdf
lsldlggtnfrvmlvkvgegeegqwsvktkhqmysipedamtgtaemlfdyisecisdfl
dkhqmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrdaikrrgd
femdvvamvndtvatmiscyyedh

Timeline for d3h1vx1:

• d3h1vx1 first appeared in SCOPe 2.03
  
• d3h1vx1 appears in SCOPe 2.05
  
• d3h1vx1 appears in the current release, SCOPe 2.08