SCOPe 2.03: Domain d3h0ta1: 3h0t A:1-111

Lineage for d3h0ta1 (3h0t A:1-111)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d3h0ta1: 3h0t A:1-111 [210776]
   Other proteins in same PDB: d3h0ta2, d3h0tc_
   automated match to d1adql1

Details for d3h0ta1

PDB Entry: 3h0t, 1.89 Å

PDB Description: Hepcidin-Fab complex

PDB Compounds: (A:) Fab fragment, light chain

SCOPe Domain Sequences for d3h0ta1:

Sequence; same for both SEQRES and ATOM records:

>d3h0ta1 b.1.1.0 (A:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfmltqphsvsespgktvtisctrssgsiasyyvqwyqqrpgsspttviyedsqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnvvfgggtkltvlg

Timeline for d3h0ta1:

• d3h0ta1 is new in SCOPe 2.03-stable
  
• d3h0ta1 appears in SCOPe 2.04
  
• d3h0ta1 appears in the current release, SCOPe 2.08