Lineage for d3h0ta2 (3h0t A:112-216)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294263Protein automated matches [190374] (12 species)
    not a true protein
  7. 1294295Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)
  8. 1294381Domain d3h0ta2: 3h0t A:112-216 [210777]
    Other proteins in same PDB: d3h0ta1, d3h0tc_
    automated match to d1adql2

Details for d3h0ta2

PDB Entry: 3h0t (more details), 1.89 Å

PDB Description: Hepcidin-Fab complex
PDB Compounds: (A:) Fab fragment, light chain

SCOPe Domain Sequences for d3h0ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3h0ta2 b.1.1.2 (A:112-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOPe Domain Coordinates for d3h0ta2:

Click to download the PDB-style file with coordinates for d3h0ta2.
(The format of our PDB-style files is described here.)

Timeline for d3h0ta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3h0ta1
View in 3D
Domains from other chains:
(mouse over for more information)
d3h0tc_