Lineage for d3gzgc_ (3gzg C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2164448Species Xanthomonas axonopodis [TaxId:92829] [225663] (1 PDB entry)
  8. 2164451Domain d3gzgc_: 3gzg C: [210737]
    automated match to d1amfa_
    complexed with moo, so4; mutant

Details for d3gzgc_

PDB Entry: 3gzg (more details), 1.55 Å

PDB Description: crystal structure of the xanthomonas axonopodis pv. citri molybdate- binding protein (moda) mutant (k127s)
PDB Compounds: (C:) Molybdate-binding periplasmic protein; permease

SCOPe Domain Sequences for d3gzgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gzgc_ c.94.1.0 (C:) automated matches {Xanthomonas axonopodis [TaxId: 92829]}
tapvtvfaaaslkesmdeaatayekatgtpvrvsyaassalarqieqgapadvflsadle
wmdylqqhglvlpaqrhnllgntlvlvapassklrvdprapgaiakalgengrlavgqta
svpagsyaaaalrklgqwdsvsnrlaesesvraalmlvsrgeaplgivygsdaradakvr
vvatfpddshdaivypvaalknsnnpataafvswlgskpakaifarrgfslk

SCOPe Domain Coordinates for d3gzgc_:

Click to download the PDB-style file with coordinates for d3gzgc_.
(The format of our PDB-style files is described here.)

Timeline for d3gzgc_: