Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins) interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain |
Protein Glucosylceramidase [89389] (1 species) glycosyl hydrolase family 30; the N-terminal extension wraps around the C-terminal core |
Species Human (Homo sapiens) [TaxId:9606] [89390] (23 PDB entries) |
Domain d3gxic1: 3gxi C:1-77,C:432-497 [210710] Other proteins in same PDB: d3gxia2, d3gxib2, d3gxic2, d3gxid2 automated match to d1ogsa1 complexed with nag, po4 |
PDB Entry: 3gxi (more details), 1.84 Å
SCOPe Domain Sequences for d3gxic1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gxic1 b.71.1.2 (C:1-77,C:432-497) Glucosylceramidase {Human (Homo sapiens) [TaxId: 9606]} arpcipksfgyssvvcvcnatycdsfdpptfpalgtfsryestrsgrrmelsmgpiqanh tgtgllltlqpeqkfqkXqrvglvasqkndldavalmhpdgsavvvvlnrsskdvpltik dpavgfletispgysihtylwhrq
Timeline for d3gxic1: