Lineage for d3gxid1 (3gxi D:1-77,D:432-497)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2400339Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2400340Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2400758Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 protein domains)
    interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain
  6. 2400815Protein Glucosylceramidase [89389] (1 species)
    glycosyl hydrolase family 30; the N-terminal extension wraps around the C-terminal core
  7. 2400816Species Human (Homo sapiens) [TaxId:9606] [89390] (17 PDB entries)
  8. 2400822Domain d3gxid1: 3gxi D:1-77,D:432-497 [210712]
    Other proteins in same PDB: d3gxia2, d3gxib2, d3gxic2, d3gxid2
    automated match to d1ogsa1
    complexed with nag, po4

Details for d3gxid1

PDB Entry: 3gxi (more details), 1.84 Å

PDB Description: Crystal structure of acid-beta-glucosidase at pH 5.5
PDB Compounds: (D:) glucosylceramidase

SCOPe Domain Sequences for d3gxid1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gxid1 b.71.1.2 (D:1-77,D:432-497) Glucosylceramidase {Human (Homo sapiens) [TaxId: 9606]}
arpcipksfgyssvvcvcnatycdsfdpptfpalgtfsryestrsgrrmelsmgpiqanh
tgtgllltlqpeqkfqkXqrvglvasqkndldavalmhpdgsavvvvlnrsskdvpltik
dpavgfletispgysihtylwhrq

SCOPe Domain Coordinates for d3gxid1:

Click to download the PDB-style file with coordinates for d3gxid1.
(The format of our PDB-style files is described here.)

Timeline for d3gxid1: