SCOPe 2.08: Domain d3gxda1: 3gxd A:1-77,A:432-497

Lineage for d3gxda1 (3gxd A:1-77,A:432-497)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
   interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain

6. Protein Glucosylceramidase [89389] (1 species)
   glycosyl hydrolase family 30; the N-terminal extension wraps around the C-terminal core

7. Species Human (Homo sapiens) [TaxId:9606] [89390] (23 PDB entries)

8. Domain d3gxda1: 3gxd A:1-77,A:432-497 [210690]
   Other proteins in same PDB: d3gxda2, d3gxdb2, d3gxdc2, d3gxdd2
   automated match to d1ogsa1
   complexed with nag, po4

Details for d3gxda1

PDB Entry: 3gxd, 2.5 Å

PDB Description: crystal structure of apo acid-beta-glucosidase ph 4.5

PDB Compounds: (A:) glucosylceramidase

SCOPe Domain Sequences for d3gxda1:

Sequence; same for both SEQRES and ATOM records:

>d3gxda1 b.71.1.2 (A:1-77,A:432-497) Glucosylceramidase {Human (Homo sapiens) [TaxId: 9606]}
arpcipksfgyssvvcvcnatycdsfdpptfpalgtfsryestrsgrrmelsmgpiqanh
tgtgllltlqpeqkfqkXqrvglvasqkndldavalmhpdgsavvvvlnrsskdvpltik
dpavgfletispgysihtylwhrq

Timeline for d3gxda1:

• d3gxda1 first appeared in SCOPe 2.03
  
• d3gxda1 appears in SCOPe 2.07