Lineage for d3gl1b1 (3gl1 B:4-191)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1606124Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1606125Protein automated matches [226839] (42 species)
    not a true protein
  7. 1606136Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225411] (5 PDB entries)
  8. 1606139Domain d3gl1b1: 3gl1 B:4-191 [210574]
    automated match to d2qw9a1
    complexed with cl, gol, mg

Details for d3gl1b1

PDB Entry: 3gl1 (more details), 1.92 Å

PDB Description: crystal structure of atpase domain of ssb1 chaperone, a member of the hsp70 family, from saccharomyces cerevisiae
PDB Compounds: (B:) Heat shock protein SSB1

SCOPe Domain Sequences for d3gl1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gl1b1 c.55.1.0 (B:4-191) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gvfqgaigidlgttyscvatyessveiianeqgnrvtpsfvaftpeerligdaaknqaal
nprntvfdakrligrrfddesvqkdmktwpfkvidvdgnpvievqyleetktfspqeisa
mvltkmkeiaeakigkkvekavitvpayfndaqrqatkdagaisglnvlriineptaaai
ayglgagk

SCOPe Domain Coordinates for d3gl1b1:

Click to download the PDB-style file with coordinates for d3gl1b1.
(The format of our PDB-style files is described here.)

Timeline for d3gl1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gl1b2