SCOPe 2.04: Domain d3g83c1: 3g83 C:235-355

Lineage for d3g83c1 (3g83 C:235-355)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (61 PDB entries)

8. Domain d3g83c1: 3g83 C:235-355 [210449]
   Other proteins in same PDB: d3g83a2, d3g83b2, d3g83c2
   complexed with ca

Details for d3g83c1

PDB Entry: 3g83, 1.9 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein d in complex with alpha 1,2 dimannose.

PDB Compounds: (C:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d3g83c1:

Sequence; same for both SEQRES and ATOM records:

>d3g83c1 d.169.1.0 (C:235-355) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

Timeline for d3g83c1:

• d3g83c1 first appeared in SCOPe 2.03
  
• d3g83c1 appears in SCOPe 2.05
  
• d3g83c1 appears in the current release, SCOPe 2.08