SCOPe 2.04: Domain d3g7ib1: 3g7i B:1-90

Lineage for d3g7ib1 (3g7i B:1-90)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class delta GST [81366] (6 species)
   formerly a part of class theta enzymes

7. Species Anopheles dirus [TaxId:7168] [224892] (2 PDB entries)

8. Domain d3g7ib1: 3g7i B:1-90 [210425]
   Other proteins in same PDB: d3g7ia2, d3g7ib2
   automated match to d1jlwa2
   complexed with gsh

Details for d3g7ib1

PDB Entry: 3g7i, 2.05 Å

PDB Description: crystal structure of a delta class gst (adgstd4-4) from anopheles dirus, with glutathione complexed in one subunit

PDB Compounds: (B:) glutathione transferase GST1-4

SCOPe Domain Sequences for d3g7ib1:

Sequence; same for both SEQRES and ATOM records:

>d3g7ib1 c.47.1.5 (B:1-90) Class delta GST {Anopheles dirus [TaxId: 7168]}
mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflklnpqhciptlvdedg
fvlwesraiqiylvekygahdadlaerlyp

Timeline for d3g7ib1:

• d3g7ib1 first appeared in SCOPe 2.03
  
• d3g7ib1 appears in SCOPe 2.05
  
• d3g7ib1 appears in the current release, SCOPe 2.08