Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
Superfamily d.167.1: Peptide deformylase [56420] (2 families) nickel-dependent enzyme |
Family d.167.1.0: automated matches [191587] (1 protein) not a true family |
Protein automated matches [191055] (20 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225635] (2 PDB entries) |
Domain d3g5pd1: 3g5p D:6-185 [210408] Other proteins in same PDB: d3g5pa2, d3g5pb2, d3g5pc2, d3g5pd2 automated match to d1vezb_ complexed with co, po4 |
PDB Entry: 3g5p (more details), 1.7 Å
SCOPe Domain Sequences for d3g5pd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g5pd1 d.167.1.0 (D:6-185) automated matches {Human (Homo sapiens) [TaxId: 9606]} fshvcqvgdpvlrgvaapveraqlggpelqrltqrlvqvmrrrrcvglsapqlgvprqvl alelpealcrecpprqralrqmepfplrvfvnpslrvldsrlvtfpegcesvagflacvp rfqavqisgldpngeqvvwqasgwaariiqhemdhlqgclfidkmdsrtftnvywmkvnd
Timeline for d3g5pd1: