SCOPe 2.07: Domain d3g5pd1: 3g5p D:6-185

Lineage for d3g5pd1 (3g5p D:6-185)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.0: automated matches [191587] (1 protein)
   not a true family

6. Protein automated matches [191055] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225635] (2 PDB entries)

8. Domain d3g5pd1: 3g5p D:6-185 [210408]
   Other proteins in same PDB: d3g5pa2, d3g5pb2, d3g5pc2, d3g5pd2
   automated match to d1vezb_
   complexed with co, po4

Details for d3g5pd1

PDB Entry: 3g5p, 1.7 Å

PDB Description: Structure and activity of human mitochondrial peptide deformylase, a novel cancer target

PDB Compounds: (D:) Peptide deformylase, mitochondrial

SCOPe Domain Sequences for d3g5pd1:

Sequence; same for both SEQRES and ATOM records:

>d3g5pd1 d.167.1.0 (D:6-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fshvcqvgdpvlrgvaapveraqlggpelqrltqrlvqvmrrrrcvglsapqlgvprqvl
alelpealcrecpprqralrqmepfplrvfvnpslrvldsrlvtfpegcesvagflacvp
rfqavqisgldpngeqvvwqasgwaariiqhemdhlqgclfidkmdsrtftnvywmkvnd

Timeline for d3g5pd1:

• d3g5pd1 first appeared in SCOPe 2.03, called d3g5pd_
  
• d3g5pd1 appears in SCOPe 2.06
  
• d3g5pd1 appears in the current release, SCOPe 2.08