Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (35 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [194605] (30 PDB entries) |
Domain d3g51a_: 3g51 A: [210376] automated match to d1gzna_ complexed with anp |
PDB Entry: 3g51 (more details), 1.8 Å
SCOPe Domain Sequences for d3g51a_:
Sequence, based on SEQRES records: (download)
>d3g51a_ d.144.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ikeiaithhvkeghekadpsqfellkvlgqgsfgkvflvkkisgsdarqlyamkvlkkat lkvrdrvrtkmerdilvevnhpfivklhyafqtegklylildflrggdlftrlskevmft eedvkfylaelalaldhlhslgiiyrdlkpenilldeeghikltdfglskesidhekkay sfcgtveymapevvnrrghtqsadwwsfgvlmfemltgtlpfqgkdrketmtmilkaklg mpqflspeaqsllrmlfkrnpanrlgagpdgveeikrhsffstidwnklyrreihppfkp
>d3g51a_ d.144.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ikeiaithhvkeghekadpsqfellkvlgqgsfgkvflvkkisgsdarqlyamkvlkkat lkvrdilvevnhpfivklhyafqtegklylildflrggdlftrlskevmfteedvkfyla elalaldhlhslgiiyrdlkpenilldeeghikltdfglskesitveymapevvnrrght qsadwwsfgvlmfemltgtlpfqgkdrketmtmilkaklgmpqflspeaqsllrmlfkrn panrlgagpdgveeikrhsffstidwnklyrreihppfkp
Timeline for d3g51a_: