SCOPe 2.03: Domain d3g4kd_: 3g4k D:

Lineage for d3g4kd_ (3g4k D:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89152] (32 PDB entries)
   Uniprot Q08499 388-713

8. Domain d3g4kd_: 3g4k D: [210364]
   automated match to d1f0ja_
   complexed with edo, mg, rol, so4, zn

Details for d3g4kd_

PDB Entry: 3g4k, 1.95 Å

PDB Description: crystal structure of human phosphodiesterase 4d with rolipram

PDB Compounds: (D:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d3g4kd_:

Sequence; same for both SEQRES and ATOM records:

>d3g4kd_ a.211.1.2 (D:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
prfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipv
dtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasai
hdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqs
lrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadl
snptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhp
lwetwadlvhpdaqdildtlednrewyqstipq

Timeline for d3g4kd_:

• d3g4kd_ is new in SCOPe 2.03-stable
  
• d3g4kd_ appears in SCOPe 2.04
  
• d3g4kd_ appears in the current release, SCOPe 2.08