![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) ![]() |
![]() | Family a.211.1.2: PDEase [48548] (7 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
![]() | Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89152] (35 PDB entries) Uniprot Q08499 388-713 |
![]() | Domain d3g4ka_: 3g4k A: [210362] automated match to d1f0ja_ complexed with edo, mg, rol, so4, zn |
PDB Entry: 3g4k (more details), 1.95 Å
SCOPe Domain Sequences for d3g4ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g4ka_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]} fgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdt litylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihd vdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslr kmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsn ptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplw etwadlvhpdaqdildtlednrewyqstip
Timeline for d3g4ka_: