Lineage for d3g29b_ (3g29 B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487377Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1487597Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 1487598Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)
  6. 1487635Protein automated matches [226861] (3 species)
    not a true protein
  7. 1487648Species Rous sarcoma virus [TaxId:11888] [225677] (7 PDB entries)
  8. 1487658Domain d3g29b_: 3g29 B: [210325]
    automated match to d1eoqa_
    mutant

Details for d3g29b_

PDB Entry: 3g29 (more details), 2.5 Å

PDB Description: crystal structure of the c-terminal domain of the rous sarcoma virus capsid protein: d179n mutant, neutral ph
PDB Compounds: (B:) gag polyprotein

SCOPe Domain Sequences for d3g29b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g29b_ a.28.3.1 (B:) automated matches {Rous sarcoma virus [TaxId: 11888]}
agpwadimqgpsesfvdfanrlikavegsnlppsarapviidcfrqksqpdiqqlirtap
stlttpgeiikyvldrq

SCOPe Domain Coordinates for d3g29b_:

Click to download the PDB-style file with coordinates for d3g29b_.
(The format of our PDB-style files is described here.)

Timeline for d3g29b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3g29a_