SCOPe 2.08: Domain d3g0qa2: 3g0q A:234-360

Lineage for d3g0qa2 (3g0q A:234-360)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.3: MutY C-terminal domain-like [103211] (2 proteins)

6. Protein Adenine glycosylase MutY, C-terminal domain [103212] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [103213] (5 PDB entries)

8. Domain d3g0qa2: 3g0q A:234-360 [210297]
   Other proteins in same PDB: d3g0qa1
   automated match to d1rrqa2
   protein/DNA complex; complexed with ca, sf4

Details for d3g0qa2

PDB Entry: 3g0q, 2.2 Å

PDB Description: crystal structure of muty bound to its inhibitor dna

PDB Compounds: (A:) A/G-specific adenine glycosylase

SCOPe Domain Sequences for d3g0qa2:

Sequence, based on SEQRES records:

>d3g0qa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
vkqvplavavladdegrvlirkrdstgllanlwefpscetdgadgkekleqmvgeqyglq
veltepivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqrvwr
eykewas

Sequence, based on observed residues (ATOM records):

>d3g0qa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
vkqvplavavladdegrvlirkrdstgllanlwefpscetdgadgkekleqmvglqvelt
epivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqrvwreyke
was

Timeline for d3g0qa2:

• d3g0qa2 first appeared in SCOPe 2.03
  
• d3g0qa2 appears in SCOPe 2.07