Lineage for d1rrqa2 (1rrq A:234-360)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971722Family d.113.1.3: MutY C-terminal domain-like [103211] (2 proteins)
  6. 2971726Protein Adenine glycosylase MutY, C-terminal domain [103212] (1 species)
  7. 2971727Species Bacillus stearothermophilus [TaxId:1422] [103213] (5 PDB entries)
  8. 2971728Domain d1rrqa2: 1rrq A:234-360 [97799]
    Other proteins in same PDB: d1rrqa1
    protein/DNA complex; complexed with ca, sf4

Details for d1rrqa2

PDB Entry: 1rrq (more details), 2.22 Å

PDB Description: MutY adenine glycosylase in complex with DNA containing an A:oxoG pair
PDB Compounds: (A:) MutY

SCOPe Domain Sequences for d1rrqa2:

Sequence, based on SEQRES records: (download)

>d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
vkqvplavavladdegrvlirkrdstgllanlwefpscetdgadgkekleqmvgeqyglq
veltepivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqrvwr
eykewas

Sequence, based on observed residues (ATOM records): (download)

>d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]}
vkqvplavavladdegrvlirkrdstgllanlwefpscetdgadgkekleqmvglqvelt
epivsfehafshlvwqltvfpgrlvhggpveepyrlapedelkayafpvshqrvwreyke
was

SCOPe Domain Coordinates for d1rrqa2:

Click to download the PDB-style file with coordinates for d1rrqa2.
(The format of our PDB-style files is described here.)

Timeline for d1rrqa2: