Lineage for d3fvbb_ (3fvb B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1264122Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1265913Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1265914Protein automated matches [190036] (19 species)
    not a true protein
  7. 1265945Species Brucella melitensis [TaxId:359391] [225607] (1 PDB entry)
  8. 1265947Domain d3fvbb_: 3fvb B: [210217]
    automated match to d1jgca_
    complexed with cl, fe, hem, imd, mg, na

Details for d3fvbb_

PDB Entry: 3fvb (more details), 1.81 Å

PDB Description: crystal structure of ferritin (bacterioferritin) from brucella melitensis
PDB Compounds: (B:) bacterioferritin

SCOPe Domain Sequences for d3fvbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fvbb_ a.25.1.0 (B:) automated matches {Brucella melitensis [TaxId: 359391]}
gsmkgepkvierlnealflelgavnqywlhyrllndwgytrlakkereesieemhhadkl
idriiflegfpnlqtvsplrigqnvkevleadlkgeydarasykesreicdklgdyvskq
lfdelladeeghidfletqldllakiggerygqlnaapade

SCOPe Domain Coordinates for d3fvbb_:

Click to download the PDB-style file with coordinates for d3fvbb_.
(The format of our PDB-style files is described here.)

Timeline for d3fvbb_: