| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (60 species) not a true protein |
| Species Brucella melitensis [TaxId:359391] [225607] (1 PDB entry) |
| Domain d3fvbb1: 3fvb B:1-159 [210217] Other proteins in same PDB: d3fvba2, d3fvbb2 automated match to d1jgca_ complexed with cl, fe, hem, imd, mg, na |
PDB Entry: 3fvb (more details), 1.81 Å
SCOPe Domain Sequences for d3fvbb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fvbb1 a.25.1.0 (B:1-159) automated matches {Brucella melitensis [TaxId: 359391]}
mkgepkvierlnealflelgavnqywlhyrllndwgytrlakkereesieemhhadklid
riiflegfpnlqtvsplrigqnvkevleadlkgeydarasykesreicdklgdyvskqlf
delladeeghidfletqldllakiggerygqlnaapade
Timeline for d3fvbb1: