Lineage for d3fvbb1 (3fvb B:1-159)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704001Species Brucella melitensis [TaxId:359391] [225607] (1 PDB entry)
  8. 2704003Domain d3fvbb1: 3fvb B:1-159 [210217]
    Other proteins in same PDB: d3fvba2, d3fvbb2
    automated match to d1jgca_
    complexed with cl, fe, hem, imd, mg, na

Details for d3fvbb1

PDB Entry: 3fvb (more details), 1.81 Å

PDB Description: crystal structure of ferritin (bacterioferritin) from brucella melitensis
PDB Compounds: (B:) bacterioferritin

SCOPe Domain Sequences for d3fvbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fvbb1 a.25.1.0 (B:1-159) automated matches {Brucella melitensis [TaxId: 359391]}
mkgepkvierlnealflelgavnqywlhyrllndwgytrlakkereesieemhhadklid
riiflegfpnlqtvsplrigqnvkevleadlkgeydarasykesreicdklgdyvskqlf
delladeeghidfletqldllakiggerygqlnaapade

SCOPe Domain Coordinates for d3fvbb1:

Click to download the PDB-style file with coordinates for d3fvbb1.
(The format of our PDB-style files is described here.)

Timeline for d3fvbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fvbb2