Lineage for d3fuvc_ (3fuv C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (64 species)
    not a true protein
  7. 2130925Species Thermus thermophilus HB8 [TaxId:300852] [225633] (5 PDB entries)
  8. 2130935Domain d3fuvc_: 3fuv C: [210184]
    automated match to d3tpzb_

Details for d3fuvc_

PDB Entry: 3fuv (more details), 1.95 Å

PDB Description: apo-form of t. thermophilus 16s rrna a1518 and a1519 methyltransferase (ksga) in space group p43212
PDB Compounds: (C:) Dimethyladenosine transferase

SCOPe Domain Sequences for d3fuvc_:

Sequence, based on SEQRES records: (download)

>d3fuvc_ c.66.1.0 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
qsvrallerhglfadkrfgqnflvseahlrriveaarpftgpvfevgpglgaltrallea
gaevtaiekdlrlrpvleetlsglpvrlvfqdallypweevpqgsllvanlpyhiatplv
trllktgrfarlvflvqkevaermtarpktpaygvltlrvahhavaerlfdlppgaffpp
pkvwsslvrltptgalddpglfrlveaafgkrrktllnalaaagypkarveealralglp
prvraeeldleafrrlregle

Sequence, based on observed residues (ATOM records): (download)

>d3fuvc_ c.66.1.0 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
qsvrallerhgnflvseahlrriveaarpftgpvfevgpglgaltralleagaevtaiek
dlrlrpvleetlsglpvrlvfqdallypweevpqgsllvanlpyhiatplvtrllktgrf
arlvflvqkevaermtarpktpaygvltlrvahhavaerlfdlppgaffpppkvwsslvr
ltptgalddpglfrlveaafgkrrktllnalaaagypkarveealralglpprvraeeld
leafrrlregle

SCOPe Domain Coordinates for d3fuvc_:

Click to download the PDB-style file with coordinates for d3fuvc_.
(The format of our PDB-style files is described here.)

Timeline for d3fuvc_: