Lineage for d3fuea3 (3fue A:461-610)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2338495Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2338800Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein)
    automatically mapped to Pfam PF09127
    this is a repeat family; one repeat unit is 1gw6 A:513-547 found in domain
  6. 2338801Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species)
  7. 2338802Species Human (Homo sapiens) [TaxId:9606] [63610] (57 PDB entries)
    Uniprot P09960
  8. 2338839Domain d3fuea3: 3fue A:461-610 [210154]
    Other proteins in same PDB: d3fuea1, d3fuea2
    automated match to d1hs6a1
    complexed with 11s, bes, imd, yb, zn

Details for d3fuea3

PDB Entry: 3fue (more details), 2.38 Å

PDB Description: Leukotriene A4 hydrolase in complex with fragment 5-chloroindole and bestatin
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d3fuea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fuea3 a.118.1.7 (A:461-610) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm
qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks
hdqavrtyqehkasmhpvtamlvgkdlkvd

SCOPe Domain Coordinates for d3fuea3:

Click to download the PDB-style file with coordinates for d3fuea3.
(The format of our PDB-style files is described here.)

Timeline for d3fuea3: