SCOPe 2.05: Domain d3fu8b3: 3fu8 B:344-559

Lineage for d3fu8b3 (3fu8 B:344-559)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)

6. Protein Laccase [49557] (5 species)
   consists of three domains of this fold

7. Species Fungus (Melanocarpus albomyces) [TaxId:204285] [74873] (9 PDB entries)

8. Domain d3fu8b3: 3fu8 B:344-559 [210142]
   automated match to d1gw0a3
   complexed with 3dm, cl, cu, gol, nag, so4

Details for d3fu8b3

PDB Entry: 3fu8, 1.8 Å

PDB Description: melanocarpus albomyces laccase crystal soaked (10 sec) with 2,6- dimethoxyphenol

PDB Compounds: (B:) Laccase-1

SCOPe Domain Sequences for d3fu8b3:

Sequence; same for both SEQRES and ATOM records:

>d3fu8b3 b.6.1.3 (B:344-559) Laccase {Fungus (Melanocarpus albomyces) [TaxId: 204285]}
rsvpvnsfvkrpdntlpvaldltgtplfvwkvngsdinvdwgkpiidyiltgntsypvsd
nivqvdavdqwtywliendpegpfslphpmhlhghdflvlgrspdvpaasqqrfvfdpav
dlarlngdnpprrdttmlpaggwlllafrtdnpgawlfhchiawhvsgglsvdflerpad
lrqrisqededdfnrvcdewraywptnpypkidsgl

Timeline for d3fu8b3:

• d3fu8b3 first appeared in SCOPe 2.03
  
• d3fu8b3 appears in SCOPe 2.04
  
• d3fu8b3 appears in SCOPe 2.06
  
• d3fu8b3 appears in the current release, SCOPe 2.08