Lineage for d3fu3a2 (3fu3 A:209-460)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1423492Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1423493Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1424355Family d.92.1.13: Leukotriene A4 hydrolase catalytic domain [64338] (1 protein)
    adopts thermolysin-like fold
  6. 1424356Protein Leukotriene A4 hydrolase catalytic domain [64339] (1 species)
  7. 1424357Species Human (Homo sapiens) [TaxId:9606] [64340] (44 PDB entries)
    Uniprot P09960
  8. 1424380Domain d3fu3a2: 3fu3 A:209-460 [210123]
    Other proteins in same PDB: d3fu3a1, d3fu3a3
    automated match to d1hs6a3
    complexed with 92g, act, imd, yb, zn

Details for d3fu3a2

PDB Entry: 3fu3 (more details), 2 Å

PDB Description: Leukotriene A4 hydrolase in complex with fragment 4-(2-amino-1,3-thiazol-4-yl)phenol
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d3fu3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fu3a2 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg
gmenpcltfvtptllagdkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhi
cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpdvayssvpyekgfa
llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl
yspglppikpny

SCOPe Domain Coordinates for d3fu3a2:

Click to download the PDB-style file with coordinates for d3fu3a2.
(The format of our PDB-style files is described here.)

Timeline for d3fu3a2: