Lineage for d3fr6a1 (3fr6 A:2-85)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484529Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2485233Protein automated matches [227019] (4 species)
    not a true protein
  7. 2485246Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [225817] (3 PDB entries)
  8. 2485249Domain d3fr6a1: 3fr6 A:2-85 [210062]
    Other proteins in same PDB: d3fr6a2, d3fr6b2
    automated match to d1pa3a2
    complexed with mg

Details for d3fr6a1

PDB Entry: 3fr6 (more details), 2.6 Å

PDB Description: tetramerization and cooperativity in plasmodium falciparum glutathione transferase are mediated by the atypic loop 113-118
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d3fr6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fr6a1 c.47.1.5 (A:2-85) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
gdnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvpi
lqigdlilaqsqaivrylskkyni

SCOPe Domain Coordinates for d3fr6a1:

Click to download the PDB-style file with coordinates for d3fr6a1.
(The format of our PDB-style files is described here.)

Timeline for d3fr6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fr6a2