SCOPe 2.08: Domain d3fo1a2: 3fo1 A:113-216

Lineage for d3fo1a2 (3fo1 A:113-216)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3fo1a2: 3fo1 A:113-216 [210019]
   Other proteins in same PDB: d3fo1a1, d3fo1l1
   automated match to d1blna2
   complexed with bzh; mutant

Details for d3fo1a2

PDB Entry: 3fo1, 2.2 Å

PDB Description: crystal structure of hapten complex of catalytic elimination antibody 13g5 (glu(l39)ala mutant)

PDB Compounds: (A:) Catalytic antibody Fab 13G5 kappa light chain chimera

SCOPe Domain Sequences for d3fo1a2:

Sequence; same for both SEQRES and ATOM records:

>d3fo1a2 b.1.1.0 (A:113-216) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d3fo1a2:

• d3fo1a2 first appeared in SCOPe 2.03
  
• d3fo1a2 appears in SCOPe 2.07