SCOPe 2.08: Domain d3fo1a1: 3fo1 A:1-112

Lineage for d3fo1a1 (3fo1 A:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d3fo1a1: 3fo1 A:1-112 [210018]
   Other proteins in same PDB: d3fo1a2, d3fo1b_, d3fo1h_, d3fo1l2
   automated match to d1blna1
   complexed with bzh; mutant

Details for d3fo1a1

PDB Entry: 3fo1, 2.2 Å

PDB Description: crystal structure of hapten complex of catalytic elimination antibody 13g5 (glu(l39)ala mutant)

PDB Compounds: (A:) Catalytic antibody Fab 13G5 kappa light chain chimera

SCOPe Domain Sequences for d3fo1a1:

Sequence; same for both SEQRES and ATOM records:

>d3fo1a1 b.1.1.1 (A:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvmtqtplslpvslgdqasiscrssqsivhsngntylawylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkinrveaedlgvyycfqgshlpptfgggtkleik

Timeline for d3fo1a1:

• d3fo1a1 first appeared in SCOPe 2.03
  
• d3fo1a1 appears in SCOPe 2.07