SCOPe 2.08: Domain d4fabl2: 4fab L:113-219

Lineage for d4fabl2 (4fab L:113-219)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (374 PDB entries)
   Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region

8. Domain d4fabl2: 4fab L:113-219 [21000]
   Other proteins in same PDB: d4fabh1, d4fabh2, d4fabl1
   part of Fab 4-4-20
   complexed with flu, mpd

Details for d4fabl2

PDB Entry: 4fab, 2.7 Å

PDB Description: three-dimensional structure of a fluorescein-fab complex crystallized in 2-methyl-2,4-pentanediol

PDB Compounds: (L:) igg2a-kappa 4-4-20 fab (light chain)

SCOPe Domain Sequences for d4fabl2:

Sequence; same for both SEQRES and ATOM records:

>d4fabl2 b.1.1.2 (L:113-219) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d4fabl2:

• d4fabl2 first appeared (with stable ids) in SCOP 1.55
  
• d4fabl2 appears in SCOPe 2.07