Lineage for d3fkka_ (3fkk A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2098336Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2098337Protein automated matches [190115] (75 species)
    not a true protein
  7. 2098419Species Azospirillum brasilense [TaxId:192] [225809] (2 PDB entries)
  8. 2098422Domain d3fkka_: 3fkk A: [209997]
    automated match to d3dz1a_
    complexed with po4

Details for d3fkka_

PDB Entry: 3fkk (more details), 2.1 Å

PDB Description: Structure of L-2-keto-3-deoxyarabonate dehydratase
PDB Compounds: (A:) L-2-keto-3-deoxyarabonate dehydratase

SCOPe Domain Sequences for d3fkka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fkka_ c.1.10.0 (A:) automated matches {Azospirillum brasilense [TaxId: 192]}
tprhrgifpvvpttfadtgdldlasqkravdfmidagsdglcilanfseqfaitdderdv
ltrtilehvagrvpvivttshystqvcaarslraqqlgaamvmamppyhgatfrvpeaqi
fefyarvsdaiaipimvqdapasgtalsapflarmareieqvayfkietpgaanklreli
rlggdaiegpwdgeeaitlladlhagatgamtgggfpdgirpileawregrhddayaryq
awlplinhenrqsgiltakalmreggviaserprhpmpelhpdtraellaiarrldplvl
rwah

SCOPe Domain Coordinates for d3fkka_:

Click to download the PDB-style file with coordinates for d3fkka_.
(The format of our PDB-style files is described here.)

Timeline for d3fkka_: