SCOPe 2.07: Domain d3fgoa1: 3fgo A:1-124,A:240-343,A:751-994

Lineage for d3fgoa1 (3fgo A:1-124,A:240-343,A:751-994)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.33: Metal cation-transporting ATPase, transmembrane domain [81666] (1 superfamily)
   core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains

4. Superfamily f.33.1: Metal cation-transporting ATPase, transmembrane domain [81665] (1 family)

5. Family f.33.1.1: Metal cation-transporting ATPase, transmembrane domain [81664] (2 proteins)

6. Protein Calcium ATPase, transmembrane domain M [81663] (1 species)
   the N-terminal 40 residues interact with /form a part of transduction domain A

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (43 PDB entries)
   Uniprot P04191

8. Domain d3fgoa1: 3fgo A:1-124,A:240-343,A:751-994 [209902]
   Other proteins in same PDB: d3fgoa2, d3fgoa3, d3fgoa4, d3fgob2, d3fgob3, d3fgob4
   automated match to d1wpga4
   complexed with acp, act, cza, k, mf4, mg, mn

Details for d3fgoa1

PDB Entry: 3fgo, 2.5 Å

PDB Description: Crystal Structure of the E2 magnesium fluoride complex of the (SR) Ca2+-ATPase with bound CPA and AMPPCP

PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d3fgoa1:

Sequence; same for both SEQRES and ATOM records:

>d3fgoa1 f.33.1.1 (A:1-124,A:240-343,A:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl
lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk
eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy
yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf
irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp
prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh
phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls
mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg

Timeline for d3fgoa1:

• d3fgoa1 first appeared in SCOPe 2.03
  
• d3fgoa1 appears in SCOPe 2.06
  
• d3fgoa1 appears in the current release, SCOPe 2.08