Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.0: automated matches [191580] (1 protein) not a true family |
Protein automated matches [191036] (8 species) not a true protein |
Species Bdellovibrio bacteriovorus [TaxId:959] [225632] (4 PDB entries) |
Domain d3ffub_: 3ffu B: [209891] automated match to d3gwyb_ protein/RNA complex; complexed with gtp, mg |
PDB Entry: 3ffu (more details), 2.8 Å
SCOPe Domain Sequences for d3ffub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ffub_ d.113.1.0 (B:) automated matches {Bdellovibrio bacteriovorus [TaxId: 959]} hwipvvagflrkdgkilvgqrpennslagqwefpggkiengetpeealarelneelgiea evgelklacthsygdvgililfyeilywkgeprakhhmmlewihpeelkhrnipeanrki lhkiykalglewr
Timeline for d3ffub_: