SCOPe 2.03: Domain d3ffua_: 3ffu A:

Lineage for d3ffua_ (3ffu A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.0: automated matches [191580] (1 protein)
   not a true family

6. Protein automated matches [191036] (8 species)
   not a true protein

7. Species Bdellovibrio bacteriovorus [TaxId:959] [225632] (4 PDB entries)

8. Domain d3ffua_: 3ffu A: [209890]
   automated match to d3gwyb_
   protein/RNA complex; complexed with gtp, mg

Details for d3ffua_

PDB Entry: 3ffu, 2.8 Å

PDB Description: structure of the rna pyrophosphohydrolase bdrpph in complex with gtp and magnesium

PDB Compounds: (A:) Probable pyrophosphohydrolase

SCOPe Domain Sequences for d3ffua_:

Sequence; same for both SEQRES and ATOM records:

>d3ffua_ d.113.1.0 (A:) automated matches {Bdellovibrio bacteriovorus [TaxId: 959]}
ghwipvvagflrkdgkilvgqrpennslagqwefpggkiengetpeealarelneelgie
aevgelklacthsygdvgililfyeilywkgeprakhhmmlewihpeelkhrnipeanrk
ilhkiykalglew

Timeline for d3ffua_:

• d3ffua_ is new in SCOPe 2.03-stable
  
• d3ffua_ appears in SCOPe 2.04
  
• d3ffua_ appears in the current release, SCOPe 2.08