SCOPe 2.04: Domain d3fe1c1: 3fe1 C:6-190

Lineage for d3fe1c1 (3fe1 C:6-190)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (42 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224896] (40 PDB entries)

8. Domain d3fe1c1: 3fe1 C:6-190 [209874]
   automated match to d2qw9a1
   complexed with adp, cl, mg, pge, po4

Details for d3fe1c1

PDB Entry: 3fe1, 2.2 Å

PDB Description: Crystal structure of the human 70kDa heat shock protein 6 (Hsp70B') ATPase domain in complex with ADP and inorganic phosphate

PDB Compounds: (C:) Heat shock 70 kDa protein 6

SCOPe Domain Sequences for d3fe1c1:

Sequence; same for both SEQRES and ATOM records:

>d3fe1c1 c.55.1.0 (C:6-190) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elavgidlgttyscvgvfqqgrveilandqgnrttpsyvaftdterlvgdaaksqaalnp
hntvfdakrligrkfadttvqsdmkhwpfrvvseggkpkvrvcyrgedktfypeeissmv
lskmketaeaylgqpvkhavitvpayfndsqrqatkdagaiaglnvlriineptaaaiay
gldrr

Timeline for d3fe1c1:

• d3fe1c1 first appeared in SCOPe 2.03
  
• d3fe1c1 appears in SCOPe 2.05
  
• d3fe1c1 appears in the current release, SCOPe 2.08